| Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
| Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) ![]() dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers |
| Family d.58.4.0: automated matches [191316] (1 protein) not a true family |
| Protein automated matches [190081] (27 species) not a true protein |
| Species Escherichia coli [TaxId:83333] [329421] (1 PDB entry) |
| Domain d5gt2c_: 5gt2 C: [329481] automated match to d2iiza_ complexed with hem |
PDB Entry: 5gt2 (more details), 2.09 Å
SCOPe Domain Sequences for d5gt2c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5gt2c_ d.58.4.0 (C:) automated matches {Escherichia coli [TaxId: 83333]}
qvqsgilpehcraaiwieanvkgevdalraasktfadklatfeakfpdahlgavvafgnn
twralsggvgaeelkdfpgygkglapttqfdvlihilslrhdvnfsvaqaameafgdcie
vkeeihgfrwveerdlsgfvdgtenpageetrrevavikdgvdaggsyvfvqrwehnlkq
lnrmsvhdqemmigrtkeaneeidgderpetshltrvdlkedgkglkivrqslpygtasg
thglyfcaycarlhnieqqllsmfgdtdgkrdamlrftkpvtggyyfapsldklma
Timeline for d5gt2c_: