Lineage for d5gt2c_ (5gt2 C:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2193227Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) (S)
    dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
  5. 2193599Family d.58.4.0: automated matches [191316] (1 protein)
    not a true family
  6. 2193600Protein automated matches [190081] (27 species)
    not a true protein
  7. 2193702Species Escherichia coli [TaxId:83333] [329421] (1 PDB entry)
  8. 2193705Domain d5gt2c_: 5gt2 C: [329481]
    automated match to d2iiza_
    complexed with hem

Details for d5gt2c_

PDB Entry: 5gt2 (more details), 2.09 Å

PDB Description: crystal structure and biochemical features of dye-decolorizing peroxidase yfex from escherichia coli o157
PDB Compounds: (C:) Probable deferrochelatase/peroxidase YfeX

SCOPe Domain Sequences for d5gt2c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gt2c_ d.58.4.0 (C:) automated matches {Escherichia coli [TaxId: 83333]}
qvqsgilpehcraaiwieanvkgevdalraasktfadklatfeakfpdahlgavvafgnn
twralsggvgaeelkdfpgygkglapttqfdvlihilslrhdvnfsvaqaameafgdcie
vkeeihgfrwveerdlsgfvdgtenpageetrrevavikdgvdaggsyvfvqrwehnlkq
lnrmsvhdqemmigrtkeaneeidgderpetshltrvdlkedgkglkivrqslpygtasg
thglyfcaycarlhnieqqllsmfgdtdgkrdamlrftkpvtggyyfapsldklma

SCOPe Domain Coordinates for d5gt2c_:

Click to download the PDB-style file with coordinates for d5gt2c_.
(The format of our PDB-style files is described here.)

Timeline for d5gt2c_: