Lineage for d1gsba2 (1gsb A:1-84)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2484063Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2484064Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2484529Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)
  6. 2484752Protein Class mu GST [81359] (3 species)
  7. 2484816Species Norway rat (Rattus norvegicus) [TaxId:10116] [52868] (16 PDB entries)
  8. 2484843Domain d1gsba2: 1gsb A:1-84 [32947]
    Other proteins in same PDB: d1gsba1, d1gsbb1, d1gsbc1, d1gsbd1
    CA-atoms only

Details for d1gsba2

PDB Entry: 1gsb (more details), 2.5 Å

PDB Description: new crystal forms of a mu class glutathione s-transferase from rat liver
PDB Compounds: (A:) glutathione s-transferase

SCOPe Domain Sequences for d1gsba2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gsba2 c.47.1.5 (A:1-84) Class mu GST {Norway rat (Rattus norvegicus) [TaxId: 10116]}
pmilgywnvrglthpirllleytdssyeekryamgdapdydrsqwlnekfklgldfpnlp
ylidgsrkitqsnaimrylarkhh

SCOPe Domain Coordinates for d1gsba2:

Click to download the PDB-style file with coordinates for d1gsba2.
(The format of our PDB-style files is described here.)

Timeline for d1gsba2: