![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like |
![]() | Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) ![]() binds cofactor molecules in the opposite direction than classical Rossmann fold |
![]() | Family c.31.1.3: Pyruvate oxidase and decarboxylase, middle domain [52475] (8 proteins) N-terminal domain is Pyr module, and C-terminal domain is PP module of thiamin diphosphate-binding fold |
![]() | Protein Acetohydroxyacid synthase catalytic subunit [69463] (3 species) |
![]() | Species Thale cress (Arabidopsis thaliana), chloroplast [TaxId:3702] [142123] (12 PDB entries) Uniprot P17597 281-459 |
![]() | Domain d5k6ra2: 5k6r A:281-459 [329463] Other proteins in same PDB: d5k6ra1, d5k6ra3 automated match to d1ybha1 complexed with 6r5, fad, k, mg, nhe, tzd |
PDB Entry: 5k6r (more details), 2.73 Å
SCOPe Domain Sequences for d5k6ra2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5k6ra2 c.31.1.3 (A:281-459) Acetohydroxyacid synthase catalytic subunit {Thale cress (Arabidopsis thaliana), chloroplast [TaxId: 3702]} pkppedshleqivrliseskkpvlyvgggclnssdelgrfveltgipvastlmglgsypc ddelslhmlgmhgtvyanyavehsdlllafgvrfddrvtgkleafasrakivhididsae igknktphvsvcgdvklalqgmnkvlenraeelkldfgvwrnelnvqkqkfplsfktfg
Timeline for d5k6ra2: