![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465 |
![]() | Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) ![]() there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules |
![]() | Family c.36.1.9: Pyruvate oxidase and decarboxylase PP module [88749] (8 proteins) the N-terminal, Pyr module is separated from the C-terminal, PP module by an alpa/beta domain of Rossmann-like topology |
![]() | Protein Acetohydroxyacid synthase catalytic subunit [88758] (3 species) |
![]() | Species Thale cress (Arabidopsis thaliana), chloroplast [TaxId:3702] [142208] (11 PDB entries) Uniprot P17597 460-667 |
![]() | Domain d5k3sa3: 5k3s A:460-667 [329460] Other proteins in same PDB: d5k3sa1, d5k3sa2, d5k3sa4 automated match to d1ybha3 complexed with 6ql, fad, mg, tp9 |
PDB Entry: 5k3s (more details), 2.87 Å
SCOPe Domain Sequences for d5k3sa3:
Sequence; same for both SEQRES and ATOM records: (download)
>d5k3sa3 c.36.1.9 (A:460-667) Acetohydroxyacid synthase catalytic subunit {Thale cress (Arabidopsis thaliana), chloroplast [TaxId: 3702]} eaippqyaikvldeltdgkaiistgvgqhqmwaaqfynykkprqwlssgglgamgfglpa aigasvanpdaivvdidgdgsfimnvqelatirvenlpvkvlllnnqhlgmvmqwedrfy kanrahtflgdpaqedeifpnmllfaaacgipaarvtkkadlreaiqtmldtpgpylldv icphqehvlpmipsggtfndvitegdgr
Timeline for d5k3sa3: