SCOPe 2.07: Domain d5k2oa2: 5k2o A:281-459

Lineage for d5k2oa2 (5k2o A:281-459)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like

4. Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families)
   binds cofactor molecules in the opposite direction than classical Rossmann fold

5. Family c.31.1.3: Pyruvate oxidase and decarboxylase, middle domain [52475] (8 proteins)
   N-terminal domain is Pyr module, and C-terminal domain is PP module of thiamin diphosphate-binding fold

6. Protein Acetohydroxyacid synthase catalytic subunit [69463] (3 species)

7. Species Thale cress (Arabidopsis thaliana), chloroplast [TaxId:3702] [142123] (12 PDB entries)
   Uniprot P17597 281-459

8. Domain d5k2oa2: 5k2o A:281-459 [329453]
   Other proteins in same PDB: d5k2oa1, d5k2oa3, d5k2oa4
   automated match to d1ybha1
   complexed with 6qk, cit, fad, mg, tp9

Details for d5k2oa2

PDB Entry: 5k2o, 2.87 Å

PDB Description: crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a pyrimidinyl-benzoate herbicide, pyrithiobac

PDB Compounds: (A:) Acetolactate synthase, chloroplastic

SCOPe Domain Sequences for d5k2oa2:

Sequence; same for both SEQRES and ATOM records:

>d5k2oa2 c.31.1.3 (A:281-459) Acetohydroxyacid synthase catalytic subunit {Thale cress (Arabidopsis thaliana), chloroplast [TaxId: 3702]}
pkppedshleqivrliseskkpvlyvgggclnssdelgrfveltgipvastlmglgsypc
ddelslhmlgmhgtvyanyavehsdlllafgvrfddrvtgkleafasrakivhididsae
igknktphvsvcgdvklalqgmnkvlenraeelkldfgvwrnelnvqkqkfplsfktfg

Timeline for d5k2oa2:

• d5k2oa2 first appeared in SCOPe 2.06
  
• d5k2oa2 appears in the current release, SCOPe 2.08