Lineage for d5idib_ (5idi B:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2416558Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2418013Family c.1.8.4: Family 1 of glycosyl hydrolase [51521] (6 protein domains)
  6. 2418178Protein automated matches [190245] (11 species)
    not a true protein
  7. 2418264Species Thermotoga neapolitana [TaxId:2337] [329442] (1 PDB entry)
  8. 2418266Domain d5idib_: 5idi B: [329451]
    automated match to d1oima_
    complexed with act; mutant

Details for d5idib_

PDB Entry: 5idi (more details), 1.9 Å

PDB Description: structure of beta glucosidase 1a from thermotoga neapolitana, mutant e349a
PDB Compounds: (B:) 1,4-beta-D-glucan glucohydrolase

SCOPe Domain Sequences for d5idib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5idib_ c.1.8.4 (B:) automated matches {Thermotoga neapolitana [TaxId: 2337]}
mkkfpegflwgvatasyqiegspladgagmsiwhtfshtpgnvkngdtgdvacdhynrwk
edieiiekigakayrfsiswprilpegtgkvnqkgldfynriidtlleknitpfitiyhw
dlpfslqlkggwanrdiadwfaeysrvlfenfgdrvkhwitlnelwvvaivghlygvhap
gmkdiyvafhtvhnllrahaksvkvfretvkdgkigivfnngyfepasereediraarfm
hqfnnyplflnpiyrgeypdlvlefareylprnyeddmeeikqeidfvglnyysghmvky
dpnsparvsfvernlpktamgweivpegiywilkgvkeeynpqevyitgngaafddvvse
ggkvhdqnridylrahieqvwraiqdgvplkgyfvwslldnfewaegyskrfgivyvdyn
tqkriikdsgywysnviknngltd

SCOPe Domain Coordinates for d5idib_:

Click to download the PDB-style file with coordinates for d5idib_.
(The format of our PDB-style files is described here.)

Timeline for d5idib_: