Lineage for d5i0ya_ (5i0y A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2767114Superfamily b.1.33: Membrane antigen precursor-like [310605] (2 families) (S)
    Pfam PF10634
  5. 2767132Family b.1.33.0: automated matches [310673] (1 protein)
    not a true family
  6. 2767133Protein automated matches [310872] (3 species)
    not a true protein
  7. 2767171Species Escherichia coli [TaxId:340197] [329434] (4 PDB entries)
  8. 2767172Domain d5i0ya_: 5i0y A: [329437]
    Other proteins in same PDB: d5i0yb2
    automated match to d3lznb_
    complexed with cu

Details for d5i0ya_

PDB Entry: 5i0y (more details), 1.4 Å

PDB Description: copper-bound e46q variant of uropathogenic escherichia coli strain f11 fetp
PDB Compounds: (A:) Periplasmic protein-probably involved in high-affinity Fe2+ transport

SCOPe Domain Sequences for d5i0ya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5i0ya_ b.1.33.0 (A:) automated matches {Escherichia coli [TaxId: 340197]}
fkeypagepvtmnemelaavylqpidmeprgmglpaakadvhlqadihavegnkngfgag
ewipyltisytlvnndtgekqegtfmpmvasdgphyganikmmgvgnykvtyhieppska
gmhrhtdsetgvgrwwkpfdvsyefkyvgl

SCOPe Domain Coordinates for d5i0ya_:

Click to download the PDB-style file with coordinates for d5i0ya_.
(The format of our PDB-style files is described here.)

Timeline for d5i0ya_: