| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
Superfamily a.24.3: Cytochromes [47175] (3 families) ![]() Heme-containing proteins |
| Family a.24.3.2: Cytochrome c'-like [47179] (3 proteins) automatically mapped to Pfam PF01322 |
| Protein Cytochrome c' [47180] (9 species) |
| Species Allochromatium vinosum [TaxId:572477] [329419] (1 PDB entry) |
| Domain d5gyri_: 5gyr I: [329431] automated match to d1bbha_ complexed with hec |
PDB Entry: 5gyr (more details), 1.6 Å
SCOPe Domain Sequences for d5gyri_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5gyri_ a.24.3.2 (I:) Cytochrome c' {Allochromatium vinosum [TaxId: 572477]}
aglspeeqietrqagyefmgwnmgkikanlegeynaaqveaaanviaaiansgmgalygp
gtdknvgdvktrvkpeffqnmedvgkiarefvgaantlaevaatgeaeavktafgdvgaa
ckschekyrak
Timeline for d5gyri_: