Lineage for d5i0vb_ (5i0v B:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2040274Superfamily b.1.33: Membrane antigen precursor-like [310605] (2 families) (S)
    Pfam PF10634
  5. 2040292Family b.1.33.0: automated matches [310673] (1 protein)
    not a true family
  6. 2040293Protein automated matches [310872] (2 species)
    not a true protein
  7. 2040294Species Campylobacter jejuni [TaxId:354242] [311313] (8 PDB entries)
  8. 2040308Domain d5i0vb_: 5i0v B: [329429]
    Other proteins in same PDB: d5i0va2
    automated match to d3lznb_
    complexed with cl, cu, fe

Details for d5i0vb_

PDB Entry: 5i0v (more details), 1.65 Å

PDB Description: iron and copper-bound p19 from campylobacter jejuni under oxidizing conditions
PDB Compounds: (B:) Protein P19

SCOPe Domain Sequences for d5i0vb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5i0vb_ b.1.33.0 (B:) automated matches {Campylobacter jejuni [TaxId: 354242]}
gevpigdpkelngmeiaavylqpiemeprgidlaasladihleadihalknnpngfpegf
wmpyltiayelkntdtgaikrgtlmpmvaddgphyganiamekdkkggfgvgnyeltfyi
snpekqgfgrhvdeetgvgkwfepfkvdykfkytgtp

SCOPe Domain Coordinates for d5i0vb_:

Click to download the PDB-style file with coordinates for d5i0vb_.
(The format of our PDB-style files is described here.)

Timeline for d5i0vb_: