| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.33: Membrane antigen precursor-like [310605] (2 families) ![]() Pfam PF10634 |
| Family b.1.33.0: automated matches [310673] (1 protein) not a true family |
| Protein automated matches [310872] (3 species) not a true protein |
| Species Campylobacter jejuni [TaxId:354242] [311313] (11 PDB entries) |
| Domain d5i0vb_: 5i0v B: [329429] Other proteins in same PDB: d5i0va2 automated match to d3lznb_ complexed with cl, cu, fe |
PDB Entry: 5i0v (more details), 1.65 Å
SCOPe Domain Sequences for d5i0vb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5i0vb_ b.1.33.0 (B:) automated matches {Campylobacter jejuni [TaxId: 354242]}
gevpigdpkelngmeiaavylqpiemeprgidlaasladihleadihalknnpngfpegf
wmpyltiayelkntdtgaikrgtlmpmvaddgphyganiamekdkkggfgvgnyeltfyi
snpekqgfgrhvdeetgvgkwfepfkvdykfkytgtp
Timeline for d5i0vb_: