Class a: All alpha proteins [46456] (289 folds) |
Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
Superfamily a.24.3: Cytochromes [47175] (3 families) Heme-containing proteins |
Family a.24.3.2: Cytochrome c'-like [47179] (3 proteins) automatically mapped to Pfam PF01322 |
Protein Cytochrome c' [47180] (9 species) |
Species Allochromatium vinosum [TaxId:572477] [329419] (1 PDB entry) |
Domain d5gyrb_: 5gyr B: [329420] automated match to d1bbha_ complexed with hem |
PDB Entry: 5gyr (more details), 1.6 Å
SCOPe Domain Sequences for d5gyrb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5gyrb_ a.24.3.2 (B:) Cytochrome c' {Allochromatium vinosum [TaxId: 572477]} aglspeeqietrqagyefmgwnmgkikanlegeynaaqveaaanviaaiansgmgalygp gtdknvgdvktrvkpeffqnmedvgkiarefvgaantlaevaatgeaeavktafgdvgaa ckschekyrak
Timeline for d5gyrb_: