Lineage for d5fwgb2 (5fwg B:1-84)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 833461Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 833462Superfamily c.47.1: Thioredoxin-like [52833] (23 families) (S)
  5. 833722Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (18 proteins)
  6. 833885Protein Class mu GST [81359] (3 species)
  7. 833947Species Rat (Rattus norvegicus) [TaxId:10116] [52868] (16 PDB entries)
  8. 833967Domain d5fwgb2: 5fwg B:1-84 [32942]
    Other proteins in same PDB: d5fwga1, d5fwgb1
    complexed with cyp, ftr; mutant

Details for d5fwgb2

PDB Entry: 5fwg (more details), 2 Å

PDB Description: tetra-(5-fluorotryptophanyl)-glutathione transferase
PDB Compounds: (B:) tetra-(5-fluorotryptophanyl)-glutathione transferase mu class

SCOP Domain Sequences for d5fwgb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5fwgb2 c.47.1.5 (B:1-84) Class mu GST {Rat (Rattus norvegicus) [TaxId: 10116]}
pmilgywnvrglthpirllleytdssyeekryamgdapdydrsqwlnekfklgldfpnlp
ylidgsrkitqsnaimrylarkhh

SCOP Domain Coordinates for d5fwgb2:

Click to download the PDB-style file with coordinates for d5fwgb2.
(The format of our PDB-style files is described here.)

Timeline for d5fwgb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5fwgb1