SCOP 1.55: Domain d5fwgb2: 5fwg B:1-84

Lineage for d5fwgb2 (5fwg B:1-84)

1. Root: SCOP 1.55

2. Class c: Alpha and beta proteins (a/b) [51349] (97 folds)

3. Fold c.47: Thioredoxin fold [52832] (3 superfamilies)

4. Superfamily c.47.1: Thioredoxin-like [52833] (10 families)

5. Family c.47.1.5: Glutathione S-transferases, N-terminal domain [52862] (2 proteins)

6. Protein Glutathione S-transferase [52863] (22 species)

7. Species Rat (Rattus norvegicus), class mu [TaxId:10116] [52868] (14 PDB entries)

8. Domain d5fwgb2: 5fwg B:1-84 [32942]
   Other proteins in same PDB: d5fwga1, d5fwgb1

Details for d5fwgb2

PDB Entry: 5fwg, 2 Å

PDB Description: tetra-(5-fluorotryptophanyl)-glutathione transferase

SCOP Domain Sequences for d5fwgb2:

Sequence, based on SEQRES records:

>d5fwgb2 c.47.1.5 (B:1-84) Glutathione S-transferase {Rat (Rattus norvegicus), class mu}
pmilgyxnvrglthpirllleytdssyeekryamgdapdydrsqxlnekfklgldfpnlp
ylidgsrkitqsnaimrylarkhh

Sequence, based on observed residues (ATOM records):

>d5fwgb2 c.47.1.5 (B:1-84) Glutathione S-transferase {Rat (Rattus norvegicus), class mu}
pmilgynvrglthpirllleytdssyeekryamgdapdydrsqlnekfklgldfpnlpyl
idgsrkitqsnaimrylarkhh

Timeline for d5fwgb2:

• d5fwgb2 appears in SCOP 1.57
  
• d5fwgb2 appears in the current release, SCOPe 2.08