SCOPe 2.07: Domain d5fwga2: 5fwg A:1-84

Lineage for d5fwga2 (5fwg A:1-84)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)

6. Protein Class mu GST [81359] (3 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [52868] (16 PDB entries)

8. Domain d5fwga2: 5fwg A:1-84 [32941]
   Other proteins in same PDB: d5fwga1, d5fwgb1
   complexed with gpr

Details for d5fwga2

PDB Entry: 5fwg, 2 Å

PDB Description: tetra-(5-fluorotryptophanyl)-glutathione transferase

PDB Compounds: (A:) tetra-(5-fluorotryptophanyl)-glutathione transferase mu class

SCOPe Domain Sequences for d5fwga2:

Sequence; same for both SEQRES and ATOM records:

>d5fwga2 c.47.1.5 (A:1-84) Class mu GST {Norway rat (Rattus norvegicus) [TaxId: 10116]}
pmilgywnvrglthpirllleytdssyeekryamgdapdydrsqwlnekfklgldfpnlp
ylidgsrkitqsnaimrylarkhh

Timeline for d5fwga2:

• d5fwga2 first appeared (with stable ids) in SCOP 1.55
  
• d5fwga2 appears in SCOPe 2.06
  
• d5fwga2 appears in the current release, SCOPe 2.08