Class a: All alpha proteins [46456] (290 folds) |
Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
Superfamily a.3.1: Cytochrome c [46626] (9 families) covalently-bound heme completes the core |
Family a.3.1.0: automated matches [191374] (1 protein) not a true family |
Protein automated matches [190453] (26 species) not a true protein |
Species Thermosynechococcus vulcanus [TaxId:32053] [329405] (6 PDB entries) |
Domain d5b66v_: 5b66 V: [329406] Other proteins in same PDB: d5b66a_, d5b66b_, d5b66c_, d5b66d_, d5b66e_, d5b66f_, d5b66h_, d5b66i_, d5b66j_, d5b66k_, d5b66l_, d5b66m_, d5b66o_, d5b66t_, d5b66u_, d5b66x_, d5b66z_ automated match to d1e29a_ complexed with bcr, bct, ca, cl, cla, dgd, dms, fe2, hec, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, rrx, sqd, unl |
PDB Entry: 5b66 (more details), 1.85 Å
SCOPe Domain Sequences for d5b66v_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5b66v_ a.3.1.0 (V:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]} aeltpevltvplnsegktitltekqylegkrlfqyacaschvggitktnpsldlrtetla latpprdnieglvdymknpttydgeqeiaevhpslrsadifpkmrnltekdlvaiaghil vepkilgdkwgggkvyy
Timeline for d5b66v_: