Lineage for d6gsta2 (6gst A:1-84)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 24115Fold c.47: Thioredoxin fold [52832] (3 superfamilies)
  4. 24116Superfamily c.47.1: Thioredoxin-like [52833] (10 families) (S)
  5. 24235Family c.47.1.5: Glutathione S-transferases, N-terminal domain [52862] (2 proteins)
  6. 24236Protein Glutathione S-transferase [52863] (22 species)
  7. 24442Species Rat (Rattus norvegicus), class mu [TaxId:10116] [52868] (14 PDB entries)
  8. 24459Domain d6gsta2: 6gst A:1-84 [32939]
    Other proteins in same PDB: d6gsta1, d6gstb1

Details for d6gsta2

PDB Entry: 6gst (more details), 2.2 Å

PDB Description: first-sphere and second-sphere electrostatic effects in the active site of a class mu glutathione transferase

SCOP Domain Sequences for d6gsta2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6gsta2 c.47.1.5 (A:1-84) Glutathione S-transferase {Rat (Rattus norvegicus), class mu}
pmilgywnvrglthpirllleytdssyeekryamgdapdydrsqwlnekfklgldfpnlp
ylidgsrkitqsnaimrylarkhh

SCOP Domain Coordinates for d6gsta2:

Click to download the PDB-style file with coordinates for d6gsta2.
(The format of our PDB-style files is described here.)

Timeline for d6gsta2:

View in 3D
Domains from same chain:
(mouse over for more information)
d6gsta1