Lineage for d5gstb2 (5gst B:1-84)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 70801Fold c.47: Thioredoxin fold [52832] (3 superfamilies)
  4. 70802Superfamily c.47.1: Thioredoxin-like [52833] (10 families) (S)
  5. 70930Family c.47.1.5: Glutathione S-transferases, N-terminal domain [52862] (3 proteins)
  6. 70934Protein Glutathione S-transferase [52863] (24 species)
  7. 71144Species Rat (Rattus norvegicus), class mu [TaxId:10116] [52868] (14 PDB entries)
  8. 71160Domain d5gstb2: 5gst B:1-84 [32938]
    Other proteins in same PDB: d5gsta1, d5gstb1

Details for d5gstb2

PDB Entry: 5gst (more details), 2 Å

PDB Description: reaction coordinate motion in an snar reaction catalyzed by glutathione transferase

SCOP Domain Sequences for d5gstb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gstb2 c.47.1.5 (B:1-84) Glutathione S-transferase {Rat (Rattus norvegicus), class mu}
pmilgywnvrglthpirllleytdssyeekryamgdapdydrsqwlnekfklgldfpnlp
ylidgsrkitqsnaimrylarkhh

SCOP Domain Coordinates for d5gstb2:

Click to download the PDB-style file with coordinates for d5gstb2.
(The format of our PDB-style files is described here.)

Timeline for d5gstb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5gstb1