SCOPe 2.08: Domain d5ue6h1: 5ue6 H:53-203

Lineage for d5ue6h1 (5ue6 H:53-203)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.0: automated matches [191502] (1 protein)
   not a true family

6. Protein automated matches [190824] (31 species)
   not a true protein

7. Species Neisseria gonorrhoeae [TaxId:242231] [255756] (4 PDB entries)

8. Domain d5ue6h1: 5ue6 H:53-203 [329353]
   Other proteins in same PDB: d5ue6a2, d5ue6b2, d5ue6c2, d5ue6d2, d5ue6e2, d5ue6f2, d5ue6g2, d5ue6h2, d5ue6i2
   automated match to d1kbva1
   complexed with cu, na

Details for d5ue6h1

PDB Entry: 5ue6, 2.35 Å

PDB Description: structure of nitrite reductase ania from neisseria gonorrhoeae, space group i4122

PDB Compounds: (H:) nitrite reductase

SCOPe Domain Sequences for d5ue6h1:

Sequence; same for both SEQRES and ATOM records:

>d5ue6h1 b.6.1.0 (H:53-203) automated matches {Neisseria gonorrhoeae [TaxId: 242231]}
elpvidavtthapevppaidrdypakvrvkmetvektmkmddgveyrywtfdgdvpgrmi
rvregdtvevefsnnpsstvphnvdfhaatgqgggaaatftapgrtstfsfkalqpglyi
yhcavapvgmhiangmyglilvepkeglpkv

Timeline for d5ue6h1:

• d5ue6h1 first appeared in SCOPe 2.06
  
• d5ue6h1 appears in SCOPe 2.07