SCOPe 2.08: Domain d5ud9l1: 5ud9 L:5-109

Lineage for d5ud9l1 (5ud9 L:5-109)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d5ud9l1: 5ud9 L:5-109 [329331]
   Other proteins in same PDB: d5ud9l2
   automated match to d4ocrl1

Details for d5ud9l1

PDB Entry: 5ud9, 1.3 Å

PDB Description: crystal structure of 354bg18 fab

PDB Compounds: (L:) light chain

SCOPe Domain Sequences for d5ud9l1:

Sequence, based on SEQRES records:

>d5ud9l1 b.1.1.0 (L:5-109) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eltqppsvsvspgqtaritcsgapltsrftywyrqkpgqapvliisrssqrssgwsgrfs
aswsgttvtltirgvqaddeadyycqssdtsdsykmfgggtkltv

Sequence, based on observed residues (ATOM records):

>d5ud9l1 b.1.1.0 (L:5-109) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eltqppsvsvspgqtaritcsgapltsrftywyrqkpgqapvliisrssqgrfsaswsgt
tvtltirgvqaddeadyycqssdtsdsykmfgggtkltv

Timeline for d5ud9l1:

• d5ud9l1 first appeared in SCOPe 2.06
  
• d5ud9l1 appears in SCOPe 2.07