SCOPe 2.08: Domain d5uizb_: 5uiz B:

Lineage for d5uizb_ (5uiz B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (27 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.0: automated matches [191341] (1 protein)
   not a true family

6. Protein automated matches [190226] (81 species)
   not a true protein

7. Species Thermobifida fusca [TaxId:2021] [256269] (2 PDB entries)

8. Domain d5uizb_: 5uiz B: [329320]
   automated match to d4gboa_
   complexed with cu, gol, iod

Details for d5uizb_

PDB Entry: 5uiz, 2 Å

PDB Description: structure of t.fusca aa10a

PDB Compounds: (B:) aa10a

SCOPe Domain Sequences for d5uizb_:

Sequence; same for both SEQRES and ATOM records:

>d5uizb_ b.1.18.0 (B:) automated matches {Thermobifida fusca [TaxId: 2021]}
hgsvinpatrnygcwlrwghdhlnpnmqyedpmcwqawqdnpnamwnwnglyrdwvggnh
raalpdgqlcsgglteggryrsmdavgpwkttdvnntftihlydqashgadyflvyvtkq
gfdpttqpltwdslelvhqtgsyppaqniqftvhapnrsgrhvvftiwkashmdqtyylc
sdvnfv

Timeline for d5uizb_:

• d5uizb_ first appeared in SCOPe 2.06
  
• d5uizb_ appears in SCOPe 2.07