| Class c: Alpha and beta proteins (a/b) [51349] (107 folds) |
| Fold c.47: Thioredoxin fold [52832] (3 superfamilies) |
Superfamily c.47.1: Thioredoxin-like [52833] (10 families) ![]() |
| Family c.47.1.5: Glutathione S-transferases, N-terminal domain [52862] (3 proteins) |
| Protein Glutathione S-transferase [52863] (24 species) |
| Species Rat (Rattus norvegicus), class mu [TaxId:10116] [52868] (14 PDB entries) |
| Domain d3gstb2: 3gst B:1-84 [32932] Other proteins in same PDB: d3gsta1, d3gstb1 |
PDB Entry: 3gst (more details), 1.9 Å
SCOP Domain Sequences for d3gstb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3gstb2 c.47.1.5 (B:1-84) Glutathione S-transferase {Rat (Rattus norvegicus), class mu}
pmilgywnvrglthpirllleytdssyeekryamgdapdydrsqwlnekfklgldfpnlp
ylidgsrkitqsnaimrylarkhh
Timeline for d3gstb2: