Lineage for d3gsta2 (3gst A:1-84)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 584500Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 584501Superfamily c.47.1: Thioredoxin-like [52833] (16 families) (S)
  5. 584721Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (16 proteins)
  6. 584855Protein Class mu GST [81359] (3 species)
  7. 584898Species Rat (Rattus norvegicus) [TaxId:10116] [52868] (16 PDB entries)
  8. 584907Domain d3gsta2: 3gst A:1-84 [32931]
    Other proteins in same PDB: d3gsta1, d3gstb1

Details for d3gsta2

PDB Entry: 3gst (more details), 1.9 Å

PDB Description: structure of the xenobiotic substrate binding site of a glutathione s- transferase as revealed by x-ray crystallographic analysis of product complexes with the diastereomers of 9-(s-glutathionyl)-10-hydroxy-9, 10-dihydrophenanthrene

SCOP Domain Sequences for d3gsta2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gsta2 c.47.1.5 (A:1-84) Class mu GST {Rat (Rattus norvegicus)}
pmilgywnvrglthpirllleytdssyeekryamgdapdydrsqwlnekfklgldfpnlp
ylidgsrkitqsnaimrylarkhh

SCOP Domain Coordinates for d3gsta2:

Click to download the PDB-style file with coordinates for d3gsta2.
(The format of our PDB-style files is described here.)

Timeline for d3gsta2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3gsta1