![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
![]() | Superfamily b.82.1: RmlC-like cupins [51182] (25 families) ![]() |
![]() | Family b.82.1.0: automated matches [191354] (1 protein) not a true family |
![]() | Protein automated matches [190388] (26 species) not a true protein |
![]() | Species Campylobacter jejuni [TaxId:197] [329306] (1 PDB entry) |
![]() | Domain d5tpua1: 5tpu A:1-132 [329307] Other proteins in same PDB: d5tpua2, d5tpud2 automated match to d2pa7a1 complexed with cl, tyd |
PDB Entry: 5tpu (more details), 2 Å
SCOPe Domain Sequences for d5tpua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5tpua1 b.82.1.0 (A:1-132) automated matches {Campylobacter jejuni [TaxId: 197]} miknckilnlrairdnrgslialennkevpfeikrvyyifdtdpnfprgahahknleqvl immsgscdiilndgknyekiclnrpdiglyigknmwremknfsygakllvlasdfydaaa yirnydeflrni
Timeline for d5tpua1:
![]() Domains from other chains: (mouse over for more information) d5tpub_, d5tpuc_, d5tpud1, d5tpud2 |