SCOPe 2.08: Domain d5tpua1: 5tpu A:1-132

Lineage for d5tpua1 (5tpu A:1-132)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (25 families)

5. Family b.82.1.0: automated matches [191354] (1 protein)
   not a true family

6. Protein automated matches [190388] (30 species)
   not a true protein

7. Species Campylobacter jejuni [TaxId:197] [329306] (1 PDB entry)

8. Domain d5tpua1: 5tpu A:1-132 [329307]
   Other proteins in same PDB: d5tpua2, d5tpud2
   automated match to d2pa7a1
   complexed with cl, tyd

Details for d5tpua1

PDB Entry: 5tpu, 2 Å

PDB Description: x-ray structure of the wlarb tdp-quinovose 3,4-ketoisomerase from campylobacter jejuni

PDB Compounds: (A:) Putative uncharacterized protein

SCOPe Domain Sequences for d5tpua1:

Sequence; same for both SEQRES and ATOM records:

>d5tpua1 b.82.1.0 (A:1-132) automated matches {Campylobacter jejuni [TaxId: 197]}
miknckilnlrairdnrgslialennkevpfeikrvyyifdtdpnfprgahahknleqvl
immsgscdiilndgknyekiclnrpdiglyigknmwremknfsygakllvlasdfydaaa
yirnydeflrni

Timeline for d5tpua1:

• d5tpua1 first appeared in SCOPe 2.06
  
• d5tpua1 appears in SCOPe 2.07