Lineage for d5l38i_ (5l38 I:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2955934Superfamily d.58.56: CcmK-like [143414] (2 families) (S)
    contains extra C-terminal helix; forms compact hexameric 'tiles' of hexagonal shape
  5. 2956023Family d.58.56.0: automated matches [195116] (1 protein)
    not a true family
  6. 2956024Protein automated matches [195117] (13 species)
    not a true protein
  7. 2956094Species Mycobacterium smegmatis [TaxId:246196] [329259] (1 PDB entry)
  8. 2956103Domain d5l38i_: 5l38 I: [329305]
    automated match to d3mpwe_
    complexed with cl, na

Details for d5l38i_

PDB Entry: 5l38 (more details), 2.2 Å

PDB Description: the structure of the hexagonal shell protein msm0272 from the rmm microcompartment
PDB Compounds: (I:) MSM0272 - RMM microcompartment shell protein

SCOPe Domain Sequences for d5l38i_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5l38i_ d.58.56.0 (I:) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
snaiglietkgyvaalaaadamvkaanvtitdrqqvgdglvavivtgevgavkaateaga
etasqvgelvsvhviprphselgahfs

SCOPe Domain Coordinates for d5l38i_:

Click to download the PDB-style file with coordinates for d5l38i_.
(The format of our PDB-style files is described here.)

Timeline for d5l38i_: