![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
![]() | Superfamily b.6.1: Cupredoxins [49503] (8 families) ![]() contains copper-binding site |
![]() | Family b.6.1.3: Multidomain cupredoxins [49550] (15 proteins) |
![]() | Protein automated matches [226877] (4 species) not a true protein |
![]() | Species Neisseria gonorrhoeae [TaxId:242231] [329297] (2 PDB entries) |
![]() | Domain d5tb7b2: 5tb7 B:204-363 [329300] Other proteins in same PDB: d5tb7a1, d5tb7b1, d5tb7c1 automated match to d1kbva2 complexed with cu, po4 |
PDB Entry: 5tb7 (more details), 1.9 Å
SCOPe Domain Sequences for d5tb7b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5tb7b2 b.6.1.3 (B:204-363) automated matches {Neisseria gonorrhoeae [TaxId: 242231]} dkefyivqgdfytkgkkgaqglqpfdmdkavaeqpeyvvfnghvgaiagdnalkakaget vrmyvgnggpnlvssfhvigeifdkvyveggklinenvqstivpaggsaivefkvdipgn ytlvdhsifrafnkgalgqlkvegaenpeimtqklsdtay
Timeline for d5tb7b2:
![]() Domains from other chains: (mouse over for more information) d5tb7a1, d5tb7a2, d5tb7c1, d5tb7c2 |