Lineage for d5tb7b2 (5tb7 B:204-363)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2770398Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2770399Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2771244Family b.6.1.3: Multidomain cupredoxins [49550] (15 proteins)
  6. 2772015Protein automated matches [226877] (4 species)
    not a true protein
  7. 2772102Species Neisseria gonorrhoeae [TaxId:242231] [329297] (2 PDB entries)
  8. 2772104Domain d5tb7b2: 5tb7 B:204-363 [329300]
    Other proteins in same PDB: d5tb7a1, d5tb7b1, d5tb7c1
    automated match to d1kbva2
    complexed with cu, po4

Details for d5tb7b2

PDB Entry: 5tb7 (more details), 1.9 Å

PDB Description: structure of nitrite reductase ania from neisseria gonorrhoeae, space group p212121
PDB Compounds: (B:) nitrite reductase

SCOPe Domain Sequences for d5tb7b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tb7b2 b.6.1.3 (B:204-363) automated matches {Neisseria gonorrhoeae [TaxId: 242231]}
dkefyivqgdfytkgkkgaqglqpfdmdkavaeqpeyvvfnghvgaiagdnalkakaget
vrmyvgnggpnlvssfhvigeifdkvyveggklinenvqstivpaggsaivefkvdipgn
ytlvdhsifrafnkgalgqlkvegaenpeimtqklsdtay

SCOPe Domain Coordinates for d5tb7b2:

Click to download the PDB-style file with coordinates for d5tb7b2.
(The format of our PDB-style files is described here.)

Timeline for d5tb7b2: