Lineage for d6gsub2 (6gsu B:1-84)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 24115Fold c.47: Thioredoxin fold [52832] (3 superfamilies)
  4. 24116Superfamily c.47.1: Thioredoxin-like [52833] (10 families) (S)
  5. 24235Family c.47.1.5: Glutathione S-transferases, N-terminal domain [52862] (2 proteins)
  6. 24236Protein Glutathione S-transferase [52863] (22 species)
  7. 24442Species Rat (Rattus norvegicus), class mu [TaxId:10116] [52868] (14 PDB entries)
  8. 24450Domain d6gsub2: 6gsu B:1-84 [32930]
    Other proteins in same PDB: d6gsua1, d6gsub1

Details for d6gsub2

PDB Entry: 6gsu (more details), 1.85 Å

PDB Description: first-sphere and second-sphere electrostatic effects in the active site of a class mu glutathione transferase

SCOP Domain Sequences for d6gsub2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6gsub2 c.47.1.5 (B:1-84) Glutathione S-transferase {Rat (Rattus norvegicus), class mu}
pmilgywnvrglahpirllleytdssyeekryamgdapdydrsqwlnekfklgldfpnlp
ylidgsrkitqsnaimrylarkhh

SCOP Domain Coordinates for d6gsub2:

Click to download the PDB-style file with coordinates for d6gsub2.
(The format of our PDB-style files is described here.)

Timeline for d6gsub2:

View in 3D
Domains from same chain:
(mouse over for more information)
d6gsub1