Lineage for d6gsua2 (6gsu A:1-84)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 123181Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
  4. 123182Superfamily c.47.1: Thioredoxin-like [52833] (12 families) (S)
  5. 123318Family c.47.1.5: Glutathione S-transferases, N-terminal domain [52862] (4 proteins)
  6. 123330Protein Glutathione S-transferase [52863] (24 species)
  7. 123540Species Rat (Rattus norvegicus), class mu [TaxId:10116] [52868] (14 PDB entries)
  8. 123547Domain d6gsua2: 6gsu A:1-84 [32929]
    Other proteins in same PDB: d6gsua1, d6gsub1

Details for d6gsua2

PDB Entry: 6gsu (more details), 1.85 Å

PDB Description: first-sphere and second-sphere electrostatic effects in the active site of a class mu glutathione transferase

SCOP Domain Sequences for d6gsua2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6gsua2 c.47.1.5 (A:1-84) Glutathione S-transferase {Rat (Rattus norvegicus), class mu}
pmilgywnvrglahpirllleytdssyeekryamgdapdydrsqwlnekfklgldfpnlp
ylidgsrkitqsnaimrylarkhh

SCOP Domain Coordinates for d6gsua2:

Click to download the PDB-style file with coordinates for d6gsua2.
(The format of our PDB-style files is described here.)

Timeline for d6gsua2:

View in 3D
Domains from same chain:
(mouse over for more information)
d6gsua1