![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.18: E set domains [81296] (27 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
![]() | Family b.1.18.8: RhoGDI-like [81288] (3 proteins) |
![]() | Protein GMP-PDE delta [74846] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [74847] (25 PDB entries) |
![]() | Domain d5ml4b_: 5ml4 B: [329283] automated match to d3t5gb_ complexed with rrq |
PDB Entry: 5ml4 (more details), 2.4 Å
SCOPe Domain Sequences for d5ml4b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ml4b_ b.1.18.8 (B:) GMP-PDE delta {Human (Homo sapiens) [TaxId: 9606]} sakderareilrgfklnwmnlrdaetgkilwqgtedlsvpgvehearvpkkilkckavsr elnfssteqmekfrleqkvyfkgqcleewffefgfvipnstntwqslieaapesqmmpas vltgnviietkffdddllvstsrvrlfyv
Timeline for d5ml4b_: