SCOPe 2.07: Domain d5hy9b1: 5hy9 B:239-339

Lineage for d5hy9b1 (5hy9 B:239-339)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma [88584] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88585] (61 PDB entries)
   Uniprot P01857 #118-327 ! Uniprot P01857 118-327 # GC1_HUMAN Ig gamma-1 chain C region

8. Domain d5hy9b1: 5hy9 B:239-339 [329281]
   Other proteins in same PDB: d5hy9a2, d5hy9b2
   automated match to d1hzhh3
   complexed with bma, fuc, gal, nag

Details for d5hy9b1

PDB Entry: 5hy9, 2.7 Å

PDB Description: glycosylated, disulfide-linked knob-into-hole fc fragment

PDB Compounds: (B:) Ig gamma-1 chain C region

SCOPe Domain Sequences for d5hy9b1:

Sequence, based on SEQRES records:

>d5hy9b1 b.1.1.2 (B:239-339) Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma {Human (Homo sapiens) [TaxId: 9606]}
svflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeqyns
tyrvvsvltvlhqdwlngkeykckvsnkalpapiektiska

Sequence, based on observed residues (ATOM records):

>d5hy9b1 b.1.1.2 (B:239-339) Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma {Human (Homo sapiens) [TaxId: 9606]}
svflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpnstyrvv
svltvlhqdwlngkeykckvsnkalpapiektiska

Timeline for d5hy9b1:

• d5hy9b1 first appeared in SCOPe 2.06
  
• d5hy9b1 appears in the current release, SCOPe 2.08