SCOPe 2.08: Domain d5ml8b_: 5ml8 B:

Lineage for d5ml8b_ (5ml8 B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (27 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.8: RhoGDI-like [81288] (3 proteins)

6. Protein GMP-PDE delta [74846] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [74847] (25 PDB entries)

8. Domain d5ml8b_: 5ml8 B: [329280]
   automated match to d3t5gb_
   complexed with v98

Details for d5ml8b_

PDB Entry: 5ml8, 2.6 Å

PDB Description: the crystal structure of pde6d in complex to inhibitor-4

PDB Compounds: (B:) Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta

SCOPe Domain Sequences for d5ml8b_:

Sequence, based on SEQRES records:

>d5ml8b_ b.1.18.8 (B:) GMP-PDE delta {Human (Homo sapiens) [TaxId: 9606]}
sakderareilrgfklnwmnlrdaetgkilwqgtedlsvpgvehearvpkkilkckavsr
elnfssteqmekfrleqkvyfkgqcleewffefgfvipnstntwqslieaapesqmmpas
vltgnviietkffdddllvstsrvrlfyv

Sequence, based on observed residues (ATOM records):

>d5ml8b_ b.1.18.8 (B:) GMP-PDE delta {Human (Homo sapiens) [TaxId: 9606]}
sakderareilrgfklnwmnlrdaetgkilwqgtedlsvpgvehearvpkkilkckavsr
elnfssteqmekfrleqkvyfkgqcleewffefgfvipnstntwqsliemmpasvltgnv
iietkffdddllvstsrvrlfyv

Timeline for d5ml8b_:

• d5ml8b_ first appeared in SCOPe 2.06
  
• d5ml8b_ appears in SCOPe 2.07