Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
Protein automated matches [190056] (165 species) not a true protein |
Species Mangifera indica [TaxId:29780] [329178] (3 PDB entries) |
Domain d5keja1: 5kej A:2-84 [329277] Other proteins in same PDB: d5keja2, d5kejb2 automated match to d5agya1 complexed with gtx, peg |
PDB Entry: 5kej (more details), 2.35 Å
SCOPe Domain Sequences for d5keja1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5keja1 c.47.1.0 (A:2-84) automated matches {Mangifera indica [TaxId: 29780]} aksdvkllgawpspyvmraritlnvksvdyelleetlgsksdlllksnpvhkkipvlihn dkpicesliivhyidefwssgps
Timeline for d5keja1: