Lineage for d5ht8a_ (5ht8 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2773464Fold b.11: gamma-Crystallin-like [49694] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key
    duplication: has internal pseudo twofold symmetry
  4. 2773465Superfamily b.11.1: gamma-Crystallin-like [49695] (7 families) (S)
  5. 2773616Family b.11.1.0: automated matches [191607] (1 protein)
    not a true family
  6. 2773617Protein automated matches [191109] (11 species)
    not a true protein
  7. 2773621Species Clostridium beijerinckii [TaxId:290402] [189152] (7 PDB entries)
  8. 2773640Domain d5ht8a_: 5ht8 A: [329268]
    automated match to d3so1h_
    complexed with ni; mutant

Details for d5ht8a_

PDB Entry: 5ht8 (more details), 2.01 Å

PDB Description: crystal structure of clostrillin double mutant (s17h,s19h) in complex with nickel
PDB Compounds: (A:) Beta and gamma crystallin

SCOPe Domain Sequences for d5ht8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ht8a_ b.11.1.0 (A:) automated matches {Clostridium beijerinckii [TaxId: 290402]}
tkavtfyedinyggahvhlqpgnytlsqlntakipndwmtslkvpsgwtvdvyendnftg
tkwtytsdtpwvgndandkmtsvkiys

SCOPe Domain Coordinates for d5ht8a_:

Click to download the PDB-style file with coordinates for d5ht8a_.
(The format of our PDB-style files is described here.)

Timeline for d5ht8a_: