| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.56: CcmK-like [143414] (2 families) ![]() contains extra C-terminal helix; forms compact hexameric 'tiles' of hexagonal shape |
| Family d.58.56.0: automated matches [195116] (1 protein) not a true family |
| Protein automated matches [195117] (12 species) not a true protein |
| Species Mycobacterium smegmatis [TaxId:246196] [329259] (1 PDB entry) |
| Domain d5l38k_: 5l38 K: [329260] automated match to d3mpwe_ complexed with cl, na |
PDB Entry: 5l38 (more details), 2.2 Å
SCOPe Domain Sequences for d5l38k_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5l38k_ d.58.56.0 (K:) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
snaiglietkgyvaalaaadamvkaanvtitdrqqvgdglvavivtgevgavkaateaga
etasqvgelvsvhviprphselgahf
Timeline for d5l38k_: