| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
| Family a.25.1.0: automated matches [191307] (1 protein) not a true family |
| Protein automated matches [190036] (60 species) not a true protein |
| Species Nostoc punctiforme [TaxId:272131] [328838] (3 PDB entries) |
| Domain d5i4jb_: 5i4j B: [329254] automated match to d4cybd_ complexed with epe, zn |
PDB Entry: 5i4j (more details), 2.39 Å
SCOPe Domain Sequences for d5i4jb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5i4jb_ a.25.1.0 (B:) automated matches {Nostoc punctiforme [TaxId: 272131]}
tllrnfgnvydnpvlldrsvtapvtegfnvvlasfqalylqyqkhhfvvegsefyslhef
fnesynqvqdhiheigerldglggvpvatfsklaeltcfeqesegvyssrqmvendlaae
qaiigvirrqaaqaeslgdrgtrylyekillkteerayhlshflakdsltlgfvqaa
Timeline for d5i4jb_: