SCOPe 2.08: Domain d5kejb2: 5kej B:85-223

Lineage for d5kejb2 (5kej B:85-223)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.0: automated matches [227130] (1 protein)
   not a true family

6. Protein automated matches [226831] (73 species)
   not a true protein

7. Species Mangifera indica [TaxId:29780] [329180] (3 PDB entries)

8. Domain d5kejb2: 5kej B:85-223 [329245]
   Other proteins in same PDB: d5keja1, d5kejb1
   automated match to d5agya2
   complexed with gtx, peg

Details for d5kejb2

PDB Entry: 5kej, 2.35 Å

PDB Description: crystallographic structure of the tau class glutathione s-transferase migstu in complex with s-hexyl-glutathione

PDB Compounds: (B:) tau class glutathione s-transferase

SCOPe Domain Sequences for d5kejb2:

Sequence; same for both SEQRES and ATOM records:

>d5kejb2 a.45.1.0 (B:85-223) automated matches {Mangifera indica [TaxId: 29780]}
ilpsdpydraiarfwaayldekwypslkgiasaqgeeakkaavdqvgeslaliedtyvkl
skgkpffggekigyldiafgcflgwlrvtektsgvkflneaktphlakwavrfcadpavk
dvmpeteklaefakllakf

Timeline for d5kejb2:

• d5kejb2 first appeared in SCOPe 2.06
  
• d5kejb2 appears in SCOPe 2.07