SCOPe 2.06: Domain d5kejb1: 5kej B:2-84

Lineage for d5kejb1 (5kej B:2-84)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (165 species)
   not a true protein

7. Species Mangifera indica [TaxId:29780] [329178] (3 PDB entries)

8. Domain d5kejb1: 5kej B:2-84 [329244]
   Other proteins in same PDB: d5keja2, d5kejb2
   automated match to d5agya1
   complexed with gtx, peg

Details for d5kejb1

PDB Entry: 5kej, 2.35 Å

PDB Description: crystallographic structure of the tau class glutathione s-transferase migstu in complex with s-hexyl-glutathione

PDB Compounds: (B:) tau class glutathione s-transferase

SCOPe Domain Sequences for d5kejb1:

Sequence; same for both SEQRES and ATOM records:

>d5kejb1 c.47.1.0 (B:2-84) automated matches {Mangifera indica [TaxId: 29780]}
aksdvkllgawpspyvmraritlnvksvdyelleetlgsksdlllksnpvhkkipvlihn
dkpicesliivhyidefwssgps

Timeline for d5kejb1:

• d5kejb1 is new in SCOPe 2.06-stable
  
• d5kejb1 appears in SCOPe 2.07
  
• d5kejb1 appears in the current release, SCOPe 2.08