Lineage for d2gstb2 (2gst B:1-84)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 991973Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 991974Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 992315Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (18 proteins)
  6. 992478Protein Class mu GST [81359] (3 species)
  7. 992540Species Norway rat (Rattus norvegicus) [TaxId:10116] [52868] (16 PDB entries)
  8. 992542Domain d2gstb2: 2gst B:1-84 [32924]
    Other proteins in same PDB: d2gsta1, d2gstb1
    complexed with gps, so4

Details for d2gstb2

PDB Entry: 2gst (more details), 1.8 Å

PDB Description: structure of the xenobiotic substrate binding site of a glutathione s- transferase as revealed by x-ray crystallographic analysis of product complexes with the diastereomers of 9-(s-glutathionyl)-10-hydroxy-9, 10-dihydrophenanthrene
PDB Compounds: (B:) glutathione s-transferase

SCOPe Domain Sequences for d2gstb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gstb2 c.47.1.5 (B:1-84) Class mu GST {Norway rat (Rattus norvegicus) [TaxId: 10116]}
pmilgywnvrglthpirllleytdssyeekryamgdapdydrsqwlnekfklgldfpnlp
ylidgsrkitqsnaimrylarkhh

SCOPe Domain Coordinates for d2gstb2:

Click to download the PDB-style file with coordinates for d2gstb2.
(The format of our PDB-style files is described here.)

Timeline for d2gstb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2gstb1