![]() | Class c: Alpha and beta proteins (a/b) [51349] (97 folds) |
![]() | Fold c.47: Thioredoxin fold [52832] (3 superfamilies) |
![]() | Superfamily c.47.1: Thioredoxin-like [52833] (10 families) ![]() |
![]() | Family c.47.1.5: Glutathione S-transferases, N-terminal domain [52862] (2 proteins) |
![]() | Protein Glutathione S-transferase [52863] (22 species) |
![]() | Species Rat (Rattus norvegicus), class mu [TaxId:10116] [52868] (14 PDB entries) |
![]() | Domain d2gstb2: 2gst B:1-84 [32924] Other proteins in same PDB: d2gsta1, d2gstb1 |
PDB Entry: 2gst (more details), 1.8 Å
SCOP Domain Sequences for d2gstb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gstb2 c.47.1.5 (B:1-84) Glutathione S-transferase {Rat (Rattus norvegicus), class mu} pmilgywnvrglthpirllleytdssyeekryamgdapdydrsqwlnekfklgldfpnlp ylidgsrkitqsnaimrylarkhh
Timeline for d2gstb2: