SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2gstb2 (2gst B:1-84)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2116932Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2116933Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2117361Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 protein domains)
  6. 2117561Protein Class mu GST [81359] (3 species)
  7. 2117623Species Norway rat (Rattus norvegicus) [TaxId:10116] [52868] (16 PDB entries)
  8. 2117625Domain d2gstb2: 2gst B:1-84 [32924]
    Other proteins in same PDB: d2gsta1, d2gstb1
    complexed with gps, so4

Details for d2gstb2

PDB Entry: 2gst (more details), 1.8 Å

PDB Description: structure of the xenobiotic substrate binding site of a glutathione s-transferase as revealed by x-ray crystallographic analysis of product complexes with the diastereomers of 9-(s-glutathionyl)-10-hydroxy-9, 10-dihydrophenanthrene
PDB Compounds: (B:) glutathione s-transferase

SCOPe Domain Sequences for d2gstb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gstb2 c.47.1.5 (B:1-84) Class mu GST {Norway rat (Rattus norvegicus) [TaxId: 10116]}
pmilgywnvrglthpirllleytdssyeekryamgdapdydrsqwlnekfklgldfpnlp
ylidgsrkitqsnaimrylarkhh

SCOPe Domain Coordinates for d2gstb2:

Click to download the PDB-style file with coordinates for d2gstb2.
(The format of our PDB-style files is described here.)

Timeline for d2gstb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2gstb1