Lineage for d5k3aa_ (5k3a A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2899459Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2899460Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2901917Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2901918Protein automated matches [190543] (131 species)
    not a true protein
  7. 2902930Species Rhodopseudomonas palustris [TaxId:258594] [329218] (38 PDB entries)
  8. 2902938Domain d5k3aa_: 5k3a A: [329232]
    automated match to d3r41b_
    complexed with cl

Details for d5k3aa_

PDB Entry: 5k3a (more details), 1.51 Å

PDB Description: crystal structure of the fluoroacetate dehalogenase rpa1163 - his280asn/fluoroacetate - cocrystallized - both protomers reacted with ligand
PDB Compounds: (A:) Fluoroacetate Dehalogenase

SCOPe Domain Sequences for d5k3aa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5k3aa_ c.69.1.0 (A:) automated matches {Rhodopseudomonas palustris [TaxId: 258594]}
ladlfpgfgsewintssgrifarvggdgppllllhgfpqthvmwhrvapklaerfkviva
dlpgygwsdmpesdeqhtpytkramakqlieameqlghvhfalaghdrgarvsyrlalds
pgrlsklavldilptyeywqrmnrayalkiyhwsflaqpaplpenllggdpdfyvkakla
swtragdlsafdpravehyriafadpmrrhvmcedyragayadfehdkidveagnkipvp
mlalwgasgiaqsaatpldvwrkwasdvqgapiesgnflpeeapdqtaealvrffs

SCOPe Domain Coordinates for d5k3aa_:

Click to download the PDB-style file with coordinates for d5k3aa_.
(The format of our PDB-style files is described here.)

Timeline for d5k3aa_: