SCOPe 2.08: Domain d5hy9a2: 5hy9 A:340-443

Lineage for d5hy9a2 (5hy9 A:340-443)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma [88589] (5 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88590] (69 PDB entries)
   Uniprot P01857 #118-327 ! Uniprot P01857 118-327 # GC1_HUMAN Ig gamma-1 chain C region

8. Domain d5hy9a2: 5hy9 A:340-443 [329231]
   Other proteins in same PDB: d5hy9a1, d5hy9b1
   automated match to d4dz8a2

Details for d5hy9a2

PDB Entry: 5hy9, 2.7 Å

PDB Description: glycosylated, disulfide-linked knob-into-hole fc fragment

PDB Compounds: (A:) Ig gamma-1 chain C region

SCOPe Domain Sequences for d5hy9a2:

Sequence; same for both SEQRES and ATOM records:

>d5hy9a2 b.1.1.2 (A:340-443) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Human (Homo sapiens) [TaxId: 9606]}
kgqprepqvytlppcrdeltknqvslwclvkgfypsdiavewesngqpennykttppvld
sdgsfflyskltvdksrwqqgnvfscsvmhealhnhytqkslsl

Timeline for d5hy9a2:

• d5hy9a2 first appeared in SCOPe 2.06
  
• d5hy9a2 appears in SCOPe 2.07