Lineage for d4gtuh2 (4gtu H:1-84)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2876589Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)
  6. 2876812Protein Class mu GST [81359] (3 species)
  7. 2876820Species Human (Homo sapiens) [TaxId:9606] [52867] (17 PDB entries)
    Uniprot P09488 ! Uniprot P28161
  8. 2876875Domain d4gtuh2: 4gtu H:1-84 [32922]
    Other proteins in same PDB: d4gtua1, d4gtub1, d4gtuc1, d4gtud1, d4gtue1, d4gtuf1, d4gtug1, d4gtuh1

Details for d4gtuh2

PDB Entry: 4gtu (more details), 3.3 Å

PDB Description: ligand-free homodimeric human glutathione s-transferase m4-4
PDB Compounds: (H:) glutathione s-transferase

SCOPe Domain Sequences for d4gtuh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gtuh2 c.47.1.5 (H:1-84) Class mu GST {Human (Homo sapiens) [TaxId: 9606]}
smtlgywdirglahairllleytdssyeekkytmgdapdydrsqwlnekfklgldfpnlp
ylidgahkitqsnailcyiarkhn

SCOPe Domain Coordinates for d4gtuh2:

Click to download the PDB-style file with coordinates for d4gtuh2.
(The format of our PDB-style files is described here.)

Timeline for d4gtuh2: