SCOPe 2.06: Domain d4gtug2: 4gtu G:1-84

Lineage for d4gtug2 (4gtu G:1-84)

Root: SCOPe 2.06
Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
Superfamily c.47.1: Thioredoxin-like [52833] (24 families)
Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)
Protein Class mu GST [81359] (3 species)
Species Human (Homo sapiens) [TaxId:9606] [52867] (16 PDB entries)
Uniprot P09488 ! Uniprot P28161
Domain d4gtug2: 4gtu G:1-84 [32921]
Other proteins in same PDB: d4gtua1, d4gtub1, d4gtuc1, d4gtud1, d4gtue1, d4gtuf1, d4gtug1, d4gtuh1

Details for d4gtug2

PDB Entry: 4gtu (more details), 3.3 Å

PDB Description: ligand-free homodimeric human glutathione s-transferase m4-4

PDB Compounds: (G:) glutathione s-transferase

SCOPe Domain Sequences for d4gtug2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gtug2 c.47.1.5 (G:1-84) Class mu GST {Human (Homo sapiens) [TaxId: 9606]}
smtlgywdirglahairllleytdssyeekkytmgdapdydrsqwlnekfklgldfpnlp
ylidgahkitqsnailcyiarkhn

SCOPe Domain Coordinates for d4gtug2:

Click to download the PDB-style file with coordinates for d4gtug2.
(The format of our PDB-style files is described here.)

Timeline for d4gtug2: