SCOP 1.55: Domain d4gtug2: 4gtu G:1-84

Lineage for d4gtug2 (4gtu G:1-84)

1. Root: SCOP 1.55

2. Class c: Alpha and beta proteins (a/b) [51349] (97 folds)

3. Fold c.47: Thioredoxin fold [52832] (3 superfamilies)

4. Superfamily c.47.1: Thioredoxin-like [52833] (10 families)

5. Family c.47.1.5: Glutathione S-transferases, N-terminal domain [52862] (2 proteins)

6. Protein Glutathione S-transferase [52863] (22 species)

7. Species Human (Homo sapiens), class mu [TaxId:9606] [52867] (7 PDB entries)

8. Domain d4gtug2: 4gtu G:1-84 [32921]
   Other proteins in same PDB: d4gtua1, d4gtub1, d4gtuc1, d4gtud1, d4gtue1, d4gtuf1, d4gtug1, d4gtuh1

Details for d4gtug2

PDB Entry: 4gtu, 3.3 Å

PDB Description: ligand-free homodimeric human glutathione s-transferase m4-4

SCOP Domain Sequences for d4gtug2:

Sequence; same for both SEQRES and ATOM records:

>d4gtug2 c.47.1.5 (G:1-84) Glutathione S-transferase {Human (Homo sapiens), class mu}
smtlgywdirglahairllleytdssyeekkytmgdapdydrsqwlnekfklgldfpnlp
ylidgahkitqsnailcyiarkhn

Timeline for d4gtug2:

• d4gtug2 appears in SCOP 1.57
  
• d4gtug2 appears in the current release, SCOPe 2.08