Lineage for d5hydb_ (5hyd B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1996349Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 1996350Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 1996383Family a.39.1.2: S100 proteins [47478] (2 proteins)
    dimer: subunits are made of two EF-hands
  6. 1996615Protein automated matches [190132] (4 species)
    not a true protein
  7. 1996618Species Human (Homo sapiens) [TaxId:9606] [187203] (42 PDB entries)
  8. 1996694Domain d5hydb_: 5hyd B: [329204]
    automated match to d2y5ic_

Details for d5hydb_

PDB Entry: 5hyd (more details), 2.3 Å

PDB Description: crystal structure of calcium-free human s100z
PDB Compounds: (B:) Protein S100-Z

SCOPe Domain Sequences for d5hydb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hydb_ a.39.1.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ptqlemamdtmirifhrysgkerkrfklskgelklllqrelteflscqketqlvdkivqd
ldankdnevdfnefvvmvaaltvacndyfveqlkk

SCOPe Domain Coordinates for d5hydb_:

Click to download the PDB-style file with coordinates for d5hydb_.
(The format of our PDB-style files is described here.)

Timeline for d5hydb_: