SCOPe 2.06: Domain d5hwha_: 5hwh A:

Lineage for d5hwha_ (5hwh A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.33: Isochorismatase-like hydrolases [52498] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.33.1: Isochorismatase-like hydrolases [52499] (2 families)

5. Family c.33.1.0: automated matches [191389] (1 protein)
   not a true family

6. Protein automated matches [190499] (22 species)
   not a true protein

7. Species Microbacterium hydrocarbonoxydans [TaxId:273678] [328695] (3 PDB entries)

8. Domain d5hwha_: 5hwh A: [329203]
   automated match to d3mcwa_
   complexed with 66z

Details for d5hwha_

PDB Entry: 5hwh, 1.79 Å

PDB Description: structure of a cysteine hydrolase with a positive substrate

PDB Compounds: (A:) Isochorismatase

SCOPe Domain Sequences for d5hwha_:

Sequence; same for both SEQRES and ATOM records:

>d5hwha_ c.33.1.0 (A:) automated matches {Microbacterium hydrocarbonoxydans [TaxId: 273678]}
prrtvvlaidlqagvtpgcfdeegvlsraaalveraraggvpvvwvhhdpvgvgtpewel
aaplhraegeplvrknyrdsfadttlretldelgathlvitgaqsdfavrttmqraaaeg
ydvtlvsdahttvdtewegvrisgeqivahtnmyfsglrypgqefviathdhval

Timeline for d5hwha_:

• d5hwha_ is new in SCOPe 2.06-stable
  
• d5hwha_ appears in SCOPe 2.07
  
• d5hwha_ appears in the current release, SCOPe 2.08