| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins) |
| Protein Class mu GST [81359] (3 species) |
| Species Human (Homo sapiens) [TaxId:9606] [52867] (17 PDB entries) Uniprot P09488 ! Uniprot P28161 |
| Domain d4gtuf2: 4gtu F:1-84 [32920] Other proteins in same PDB: d4gtua1, d4gtub1, d4gtuc1, d4gtud1, d4gtue1, d4gtuf1, d4gtug1, d4gtuh1 |
PDB Entry: 4gtu (more details), 3.3 Å
SCOPe Domain Sequences for d4gtuf2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4gtuf2 c.47.1.5 (F:1-84) Class mu GST {Human (Homo sapiens) [TaxId: 9606]}
smtlgywdirglahairllleytdssyeekkytmgdapdydrsqwlnekfklgldfpnlp
ylidgahkitqsnailcyiarkhn
Timeline for d4gtuf2: