Lineage for d5g5ea1 (5g5e A:2-84)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878967Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2878968Protein automated matches [190056] (195 species)
    not a true protein
  7. 2879971Species Mangifera indica [TaxId:29780] [329178] (3 PDB entries)
  8. 2879972Domain d5g5ea1: 5g5e A:2-84 [329182]
    Other proteins in same PDB: d5g5ea2
    automated match to d5agya1
    complexed with act, peg

Details for d5g5ea1

PDB Entry: 5g5e (more details), 1.8 Å

PDB Description: crystallographic structure of the tau class glutathione s-transferase migstu from mango mangifera indica l.
PDB Compounds: (A:) tau class glutathione s-transferase

SCOPe Domain Sequences for d5g5ea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5g5ea1 c.47.1.0 (A:2-84) automated matches {Mangifera indica [TaxId: 29780]}
aksdvkllgawpspyvmraritlnvksvdyelleetlgsksdlllksnpvhkkipvlihn
dkpicesliivhyidefwssgps

SCOPe Domain Coordinates for d5g5ea1:

Click to download the PDB-style file with coordinates for d5g5ea1.
(The format of our PDB-style files is described here.)

Timeline for d5g5ea1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5g5ea2