SCOPe 2.08: Domain d5g5ea1: 5g5e A:2-84

Lineage for d5g5ea1 (5g5e A:2-84)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (195 species)
   not a true protein

7. Species Mangifera indica [TaxId:29780] [329178] (3 PDB entries)

8. Domain d5g5ea1: 5g5e A:2-84 [329182]
   Other proteins in same PDB: d5g5ea2
   automated match to d5agya1
   complexed with act, peg

Details for d5g5ea1

PDB Entry: 5g5e, 1.8 Å

PDB Description: crystallographic structure of the tau class glutathione s-transferase migstu from mango mangifera indica l.

PDB Compounds: (A:) tau class glutathione s-transferase

SCOPe Domain Sequences for d5g5ea1:

Sequence; same for both SEQRES and ATOM records:

>d5g5ea1 c.47.1.0 (A:2-84) automated matches {Mangifera indica [TaxId: 29780]}
aksdvkllgawpspyvmraritlnvksvdyelleetlgsksdlllksnpvhkkipvlihn
dkpicesliivhyidefwssgps

Timeline for d5g5ea1:

• d5g5ea1 first appeared in SCOPe 2.06
  
• d5g5ea1 appears in SCOPe 2.07