Lineage for d5g5fa2 (5g5f A:85-221)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712830Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2712831Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2713795Family a.45.1.0: automated matches [227130] (1 protein)
    not a true family
  6. 2713796Protein automated matches [226831] (73 species)
    not a true protein
  7. 2714070Species Mangifera indica [TaxId:29780] [329180] (3 PDB entries)
  8. 2714072Domain d5g5fa2: 5g5f A:85-221 [329181]
    Other proteins in same PDB: d5g5fa1
    automated match to d5agya2
    complexed with gsh, peg

Details for d5g5fa2

PDB Entry: 5g5f (more details), 2.3 Å

PDB Description: crystallographic structure of the tau class glutathione s-transferase migstu in complex with reduced glutathione.
PDB Compounds: (A:) tau class glutathione s-transferase

SCOPe Domain Sequences for d5g5fa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5g5fa2 a.45.1.0 (A:85-221) automated matches {Mangifera indica [TaxId: 29780]}
ilpsdpydraiarfwaayldekwypslkgiasaqgeeakkaavdqvgeslaliedtyvkl
skgkpffggekigyldiafgcflgwlrvtektsgvkflneaktphlakwavrfcadpavk
dvmpeteklaefaklla

SCOPe Domain Coordinates for d5g5fa2:

Click to download the PDB-style file with coordinates for d5g5fa2.
(The format of our PDB-style files is described here.)

Timeline for d5g5fa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5g5fa1