![]() | Class c: Alpha and beta proteins (a/b) [51349] (97 folds) |
![]() | Fold c.47: Thioredoxin fold [52832] (3 superfamilies) |
![]() | Superfamily c.47.1: Thioredoxin-like [52833] (10 families) ![]() |
![]() | Family c.47.1.5: Glutathione S-transferases, N-terminal domain [52862] (2 proteins) |
![]() | Protein Glutathione S-transferase [52863] (22 species) |
![]() | Species Human (Homo sapiens), class mu [TaxId:9606] [52867] (7 PDB entries) |
![]() | Domain d4gtud2: 4gtu D:1-84 [32918] Other proteins in same PDB: d4gtua1, d4gtub1, d4gtuc1, d4gtud1, d4gtue1, d4gtuf1, d4gtug1, d4gtuh1 |
PDB Entry: 4gtu (more details), 3.3 Å
SCOP Domain Sequences for d4gtud2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4gtud2 c.47.1.5 (D:1-84) Glutathione S-transferase {Human (Homo sapiens), class mu} smtlgywdirglahairllleytdssyeekkytmgdapdydrsqwlnekfklgldfpnlp ylidgahkitqsnailcyiarkhn
Timeline for d4gtud2: