Lineage for d4gtud2 (4gtu D:1-84)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 24115Fold c.47: Thioredoxin fold [52832] (3 superfamilies)
  4. 24116Superfamily c.47.1: Thioredoxin-like [52833] (10 families) (S)
  5. 24235Family c.47.1.5: Glutathione S-transferases, N-terminal domain [52862] (2 proteins)
  6. 24236Protein Glutathione S-transferase [52863] (22 species)
  7. 24279Species Human (Homo sapiens), class mu [TaxId:9606] [52867] (7 PDB entries)
  8. 24300Domain d4gtud2: 4gtu D:1-84 [32918]
    Other proteins in same PDB: d4gtua1, d4gtub1, d4gtuc1, d4gtud1, d4gtue1, d4gtuf1, d4gtug1, d4gtuh1

Details for d4gtud2

PDB Entry: 4gtu (more details), 3.3 Å

PDB Description: ligand-free homodimeric human glutathione s-transferase m4-4

SCOP Domain Sequences for d4gtud2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gtud2 c.47.1.5 (D:1-84) Glutathione S-transferase {Human (Homo sapiens), class mu}
smtlgywdirglahairllleytdssyeekkytmgdapdydrsqwlnekfklgldfpnlp
ylidgahkitqsnailcyiarkhn

SCOP Domain Coordinates for d4gtud2:

Click to download the PDB-style file with coordinates for d4gtud2.
(The format of our PDB-style files is described here.)

Timeline for d4gtud2: